Protein List

Found 310 entries.


ID Name Sequence
1 kalata B1 GLPVCGETCVGGTCNTPGCTCSWPVCTRN
2 cycloviolacin O1 GIPCAESCVYIPCTVTALLGCSCSNRVCYN
4 kalata B2 GLPVCGETCFGGTCNTPGCSCTWPICTRD
5 palicourein GDPTFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRN
6 vhr1 GIPCAESCVWIPCTVTALLGCSCSNKVCYN
7 tricyclon A GGTIFDCGESCFLGTCYTKGCSCGEWKLCYGTN
8 circulin A GIPCGESCVWIPCISAALGCSCKNKVCYRN
21 cycloviolacin O2 GIPCGESCVWIPCISSAIGCSCKSKVCYRN
24 kalata B6 GLPTCGETCFGGTCNTPGCSCSSWPICTRN
25 kalata B3 GLPTCGETCFGGTCNTPGCTCDPWPICTRD
26 kalata B7 GLPVCGETCTLGTCYTQGCTCSWPICKRN
27 cycloviolacin O8 GTLPCGESCVWIPCISSVVGCSCKSKVCYKN
28 cycloviolacin O11 GTLPCGESCVWIPCISAVVGCSCKSKVCYKN
30 kalata B4 GLPVCGETCVGGTCNTPGCTCSWPVCTRD
31 vodo M GAPICGESCFTGKCYTVQCSCSWPVCTRN
32 cyclopsychotride A SIPCGESCVFIPCTVTALLGCSCKSKVCYKN
33 cycloviolacin H1 GIPCGESCVYIPCLTSAIGCSCKSKVCYRN
34 cycloviolacin O9 GIPCGESCVWIPCLTSAVGCSCKSKVCYRN
35 vico A GSIPCAESCVYIPCFTGIAGCSCKNKVCYYN
36 vitri A GIPCGESCVWIPCITSAIGCSCKSKVCYRN
37 kalata S GLPVCGETCVGGTCNTPGCSCSWPVCTRN
38 cycloviolacin O12 GLPICGETCVGGTCNTPGCSCSWPVCTRN
40 vodo N GLPVCGETCTLGKCYTAGCSCSWPVCYRN
41 vico B GSIPCAESCVYIPCITGIAGCSCKNKVCYYN
43 Hypa A GIPCAESCVYIPCTITALLGCSCKNKVCYN
45 circulin B GVIPCGESCVFIPCISTLLGCSCKNKVCYRN
48 circulin C GIPCGESCVFIPCITSVAGCSCKSKVCYRN
49 circulin D KIPCGESCVWIPCVTSIFNCKCENKVCYHD
50 circulin E KIPCGESCVWIPCLTSVFNCKCENKVCYHD
51 circulin F AIPCGESCVWIPCISAAIGCSCKNKVCYR
52 cycloviolacin O4 GIPCGESCVWIPCISSAIGCSCKNKVCYRN
53 cycloviolacin O3 GIPCGESCVWIPCLTSAIGCSCKSKVCYRN
54 cycloviolacin O5 GTPCGESCVWIPCISSAVGCSCKNKVCYKN
55 cycloviolacin O6 GTLPCGESCVWIPCISAAVGCSCKSKVCYKN
56 cycloviolacin O7 SIPCGESCVWIPCTITALAGCKCKSKVCYN
57 cycloviolacin O10 GIPCGESCVYIPCLTSAVGCSCKSKVCYRN
59 kalata B5 GTPCGESCVYIPCISGVIGCSCTDKVCYLN
61 varv peptide B GLPVCGETCFGGTCNTPGCSCDPWPMCSRN
62 varv peptide C GVPICGETCVGGTCNTPGCSCSWPVCTRN
63 varv peptide D GLPICGETCVGGSCNTPGCSCSWPVCTRN
64 varv peptide F GVPICGETCTLGTCYTAGCSCSWPVCTRN
65 varv peptide G GVPVCGETCFGGTCNTPGCSCDPWPVCSRN
66 varv peptide H GLPVCGETCFGGTCNTPGCSCETWPVCSRN
67 cycloviolin A GVIPCGESCVFIPCISAAIGCSCKNKVCYRN
68 cycloviolin B GTACGESCYVLPCFTVGCTCTSSQCFKN
69 cycloviolin C GIPCGESCVFIPCLTTVAGCSCKNKVCYRN
70 cycloviolin D GFPCGESCVFIPCISAAIGCSCKNKVCYRN
72 violapeptide 1 GLPVCGETCVGGTCNTPGCSCSRPVCTXN
86 vhl-1 SISCGESCAMISFCFTEVIGCSCKNKVCYLN
113 hcf-1 GIPCGESCHYIPCVTSAIGCSCRNRSCMRN
114 htf-1 GIPCGDSCHYIPCVTSTIGCSCTNGSCMRN
138 vhl-2 GLPVCGETCFTGTCYTNGCTCDPWPVCTRN
139 cycloviolacin H3 GLPVCGETCFGGTCNTPGCICDPWPVCTRN
140 cycloviolacin H2 SAIACGESCVYIPCFIPGCSCRNRVCYLN
141 Hyfl A SISCGESCVYIPCTVTALVGCTCKDKVCYLN
142 Hyfl B GSPIQCAETCFIGKCYTEELGCTCTAFLCMKN
143 Hyfl C GSPRQCAETCFIGKCYTEELGCTCTAFLCMKN
144 Hyfl D GSVPCGESCVYIPCFTGIAGCSCKSKVCYYN
145 Hyfl E GEIPCGESCVYLPCFLPNCYCRNHVCYLN
146 Hyfl F SISCGETCTTFNCWIPNCKCNHHDKVCYWN
149 Hyfl I GIPCGESCVFIPCISGVIGCSCKSKVCYRN
150 Hyfl J GIACGESCAYFGCWIPGCSCRNKVCYFN
151 Hyfl K GTPCGESCVYIPCFTAVVGCTCKDKVCYLN
152 Hyfl L GTPCAESCVYLPCFTGVIGCTCKDKVCYLN
153 Hyfl M GNIPCGESCIFFPCFNPGCSCKDNLCYYN
167 tricyclon B GGTIFDCGESCFLGTCYTKGCSCGEWKLCYGEN
168 kalata B8 GSVLNCGETCLLGTCYTTGCTCNKYRVCTKD
169 cycloviolacin H4 GIPCAESCVWIPCTVTALLGCSCSNNVCYN
170 cycloviolacin O13 GIPCGESCVWIPCISAAIGCSCKSKVCYRN
172 violacin A SAISCGETCFKFKCYTPRCSCSYPVCK
174 cycloviolacin O14 GSIPACGESCFKGKCYTPGCSCSKYPLCAKN
175 cycloviolacin O15 GLVPCGETCFTGKCYTPGCSCSYPICKKN
176 cycloviolacin O16 GLPCGETCFTGKCYTPGCSCSYPICKKIN
177 cycloviolacin O17 GIPCGESCVWIPCISAAIGCSCKNKVCYRN
178 cycloviolacin O18 GIPCGESCVYIPCTVTALAGCKCKSKVCYN
179 cycloviolacin O19 GTLPCGESCVWIPCISSVVGCSCKSKVCYKD
180 cycloviolacin O20 GIPCGESCVWIPCLTSAIGCSCKSKVCYRD
181 cycloviolacin O21 GLPVCGETCVTGSCYTPGCTCSWPVCTRN
182 cycloviolacin O22 GLPICGETCVGGTCNTPGCTCSWPVCTRN
183 cycloviolacin O23 GLPTCGETCFGGTCNTPGCTCDSSWPICTHN
184 cycloviolacin O24 GLPTCGETCFGGTCNTPGCTCDPWPVCTHN
185 cycloviolacin O25 DIFCGETCAFIPCITHVPGTCSCKSKVCYFN
244 kalata B9 GSVFNCGETCVLGTCYTPGCTCNTYRVCTKD
245 kalata B9 linear GSVFNCGETCVLGTCYTPGCTCNTYRVCTKD
246 kalata B10 GLPTCGETCFGGTCNTPGCSCSSWPICTRD
247 kalata B10 linear GLPTCGETCFGGTCNTPGCSCSSWPICTRD
249 kalata B11 GLPVCGETCFGGTCNTPGCSCTDPICTRD
250 kalata B12 GSLCGDTCFVLGCNDSSCSCNYPICVKD
251 kalata B13 GLPVCGETCFGGTCNTPGCACDPWPVCTRD
252 kalata B14 GLPVCGESCFGGTCNTPGCACDPWPVCTRD
253 kalata B15 GLPVCGESCFGGSCYTPGCSCTWPICTRD
254 kalata B16 GIPCAESCVYIPCTITALLGCKCQDKVCYD
255 kalata B17 GIPCAESCVYIPCTITALLGCKCKDQVCYN
344 kalata B18 GVPCAESCVYIPCISTVLGCSCSNQVCYRN
345 PS-1 GFIPCGETCIWDKTCHAAGCSCSVANICVRN
346 CD-1 GADGFCGESCYVIPCISYLVGCSCDTIEKVCKRN
347 cycloviolacin Y1 GGTIFDCGETCFLGTCYTPGCSCGNYGFCYGTN
348 cycloviolacin Y2 GGTIFDCGESCFLGTCYTAGCSCGNWGLCYGTN
349 cycloviolacin Y3 GGTIFDCGETCFLGTCYTAGCSCGNWGLCYGTN
350 cycloviolacin Y4 GVPCGESCVFIPCITGVIGCSCSSNVCYLN
351 cycloviolacin Y5 GIPCAESCVWIPCTVTALVGCSCSDKVCYN
352 vibi A GLPVCGETCFGGTCNTPGCSCSYPICTRN
353 vibi B GLPVCGETCFGGTCNTPGCTCSYPICTRN
354 vibi C GLPVCGETCAFGSCYTPGCSCSWPVCTRN
355 vibi D GLPVCGETCFGGRCNTPGCTCSYPICTRN
356 vibi E GIPCAESCVWIPCTVTALIGCGCSNKVCYN
357 vibi F GTIPCGESCVFIPCLTSALGCSCKSKVCYKN
358 vibi G GTFPCGESCVFIPCLTSAIGCSCKSKVCYKN
359 vibi H GLLPCAESCVYIPCLTTVIGCSCKSKVCYKN
360 vibi I GIPCGESCVWIPCLTSTVGCSCKSKVCYRN
361 vibi J GTFPCGESCVWIPCISKVIGCACKSKVCYKN
362 vibi K GIPCGESCVWIPCLTSAVGCPCKSKVCYRN
375 Viba 2 GIPCGESCVYLPCFTAPLGCSCSSKVCYRN
376 Viba 5 GIPCGESCVWIPCLTATIGCSCKSKVCYRN
377 Viba 10 GIPCAESCVYLPCVTIVIGCSCKDKVCYN
378 Viba 12 GIPCAESCVWIPCTVTALLGCSCKDKVCYN
379 Viba 14 GRLCGERCVIERTRAWCRTVGCICSLHTLECVRN
384 Viba 17 GLPVCGETCVGGTCNTPGCGCSWPVCTRN
386 Viba 15 GLPVCGETCVGGTCNTPGCACSWPVCTRN
388 Mra4 GSIPCGESCVYIPCISSLLGCSCKSKVCYKN
389 Mra5 GIPCAESCVYIPCLTSAIGCSCKSKVCYRN
390 Mra13 GIPCGESCVYLPCFTTIIGCKCQGKVCYH
392 Mra14a GSIPCGESCVFIPCISSVVGCSCKNKVCYKN
393 Mra14b GTIPCGESCVFIPCLTSAIGCSCKSKVCYKN
397 Mra17 GSIPCGESCVYIPCISSLLGCSCESKVCYKN
399 Mra29 GSIPCGESCVFIPCISSIVGCSCKSKVCYKN
400 Mra30 GIPCGESCVFIPCLTSAIGCSCKSKVCYRN
405 Mra22 GVPCGESCVWIPCLTSIVGCSCKNNVCTLN
407 Mra23 GVIPCGESCVFIPCISSVLGCSCKNKVCYRN
409 Mra24 GHPTCGETCLLGTCYTPGCTCKRPVCYKN
411 Mra25 GSAILCGESCTLGECYTPGCTCSWPICTKN
413 Mra26 GHPICGETCVGNKCYTPGCTCTWPVCYRN
417 Mra30 GSIPCGEGCVFIPCISSIVGCSCKSKVCYKN
425 Viba 1 GIPCGEGCVYLPCFTAPLGCSCSSKVCYRN
428 Viba 3 GIPCGESCVWIPCLTAAIGCSCSSKVCYRN
430 Viba 4 GVPCGESCVWIPCLTSAIGCSCKSSVCYRN
433 Viba 6 GIPCGESCVLIPCISSVIGCSCKSKVCYRN
436 Viba 7 GVIPCGESCVFIPCISSVIGCSCKSKVCYRN
439 Viba 8 GAGCIETCYTFPCISEMINCSCKNSRCQKN
440 Viba 9 GIPCGESCVWIPCISSAIGCSCKNKVCYRK
443 Viba 11 GIPCGESCVWIPCISGAIGCSCKSKVCYRN
447 Viba 13 TIPCAESCVWIPCTVTALLGCSCKDKVCYN
452 Viba 16 GLPICGETCTLGTCYTVGCTCSWPICTRN
477 Cter A GVIPCGESCVFIPCISTVIGCSCKNKVCYRN
478 Cter B GVPCAESCVWIPCTVTALLGCSCKDKVCYLN
501 hcf-1 variant GIPCGESCHIPCVTSAIGCSCRNRSCMRN
502 Vpl-1 GSQSCGESCVLIPCISGVIGCSCSSMICYFN
503 Vpf-1 GIPCGESCVFIPCLTAAIGCSCRSKVCYRN
505 cO31 GLPVCGETCVGGTCNTPGCSCSIPVCTRN
507 cO28 GLPVCGETCVGGTCNTPGCSCSWPVCFRD
508 cO32 GAPVCGETCFGGTCNTPGCTCDPWPVCTND
509 cO33 GLPVCGETCVGGTCNTPYCTCSWPVCTRD
512 cO34 GLPVCGETCVGGTCNTEYCTCSWPVCTRD
513 cO35 GLPVCGETCVGGTCNTPYCFCSWPVCTRD
514 cO29 GIPCGESCVWIPCISGAIGCSCKSKVCYKN
515 cO30 GIPCGESCVWIPCISSAIGCSCKNKVCFKN
516 cO26 GSIPACGESCFRGKCYTPGCSCSKYPLCAKD
517 cO27 GSIPACGESCFKGWCYTPGCSCSKYPLCAKD
533 Globa F GSFPCGESCVFIPCISAIAGCSCKNKVCYKN
534 Globa A GIPCGESCVFIPCITAAIGCSCKTKVCYRN
535 Globa B GVIPCGESCVFIPCISAVLGCSCKSKVCYRN
536 Globa D GIPCGETCVFMPCISGPMGCSCKHMVCYRN
538 Globa E GSAFGCGETCVKGKCNTPGCVCSWPVCKKN
539 Globa C APCGESCVFIPCISAVLGCSCKSKVCYRN
540 Glopa D GVPCGESCVWVPCTVTALMGCSCVREVCRKD
541 Glopa E GIPCAESCVWIPCTVTKMLGCSCKDKVCYN
542 Glopa A GGSIPCIETCVWTGCFLVPGCSCKSDKKCYLN
543 Glopa B GGSVPCIETCVWTGCFLVPGCSCKSDKKCYLN
544 Glopa C GDIPLCGETCFEGGNCRIPGCTCVWPFCSKN
546 Co36 GLPTCGETCFGGTCNTPGCTCDPFPVCTHD
550 cycloviolacin T1 GIPVCGETCVGGTCNTPGCSCSWPVCTRN
552 psyle A GIACGESCVFLGCFIPGCSCKSKVCYFN
553 psyle B GIPCGETCVAFGCWIPGCSCKDKLCYYD
554 psyle C KLCGETCFKFKCYTPGCSCSYFPCK
555 psyle D GIPCGESCVFIPCTVTALLGCSCQNKVCYRD
556 psyle E GVIPCGESCVFIPCISSVLGCSCKNKVCYRD
557 psyle F GVIPCGESCVFIPCITAAVGCSCKNKVCYRD
558 vaby A GLPVCGETCAGGTCNTPGCSCSWPICTRN
559 vaby B GLPVCGETCAGGTCNTPGCSCTWPICTRN
560 vaby C GLPVCGETCAGGRCNTPGCSCSWPVCTRN
561 vaby D GLPVCGETCFGGTCNTPGCTCDPWPVCTRN
562 vaby E GLPVCGETCFGGTCNTPGCSCDPWPVCTRN
563 kalata B19 GFPCGESCVYVPCLTAAIGCSCSNKVCYKN
573 Oak6 cyclotide 2 GLPICGETCFGGTCNTPGCICDPWPVCTRD
574 Oak7 cyclotide GSHCGETCFFFGCYKPGCSCDELRQCYKN
575 Oak8 cyclotide GVPCGESCVFIPCLTAVVGCSCSNKVCYLN
576 Oak6 cyclotide 1 GLPVCGETCFGGTCNTPGCACDPWPVCTRN
585 Cter C GVPCAESCVWIPCTVTALLGCSCKDKVCYLD
586 Cter D GIPCAESCVWIPCTVTALLGCSCKDKVCYLN
587 Cter E GIPCAESCVWIPCTVTALLGCSCKDKVCYLD
588 Cter F GIPCGESCVFIPCISSVVGCSCKSKVCYLD
589 Cter G GLPCGESCVFIPCITTVVGCSCKNKVCYNN
590 Cter H GLPCGESCVFIPCITTVVGCSCKNKVCYND
591 Cter I GTVPCGESCVFIPCITGIAGCSCKNKVCYIN
592 Cter J GTVPCGESCVFIPCITGIAGCSCKNKVCYID
593 Cter K HEPCGESCVFIPCITTVVGCSCKNKVCYN
594 Cter L HEPCGESCVFIPCITTVVGCSCKNKVCYD
595 Cter M GLPTCGETCTLGTCYVPDCSCSWPICMKN
596 Cter N GSAFCGETCVLGTCYTPDCSCTALVCLKN
597 Cter O GIPCGESCVFIPCITGIAGCSCKSKVCYRN
598 Cter P GIPCGESCVFIPCITAAIGCSCKSKVCYRN
599 Cter Q GIPCGESCVFIPCISTVIGCSCKNKVCYRN
600 Cter R GIPCGESCVFIPCTVTALLGCSCKDKVCYKN
601 vitri B GVPICGESCVGGTCNTPGCSCSWPVCTTN
602 vitri C GLPICGETCVGGTCNTPGCFCTWPVCTRN
603 vitri D GLPVCGETCFTGSCYTPGCSCNWPVCNRN
604 vitri E GLPVCGETCVGGTCNTPGCSCSWPVCFRN
605 vitri F GLTPCGESCVWIPCISSVVGCACKSKVCYKD
613 hedyotide B1 GTRCGETCFVLPCWSAKFGCYCQKGFCYRN
744 Parigidin-br1 GGSVPCGESCVFIPCITSLAGCSCKNKVCYYD
746 hedyotide B2 GIQCGESCVWIPCISSAWGCSCKNKICSS
748 viphi A GSIPCGESCVFIPCISSVIGCACKSKVCYKN
749 viphi B GLPVCGETCTIGTCYTAGCTCSWPICTRN
750 viphi C GVPCGESCVYIPCITSVIGCSCSSKVCYIN
751 viphi D GIPCGESCVFIPCISSVIGCSCSSKVCYRN
752 viphi E GSIPCGESCVFIPCISAVIGCSCSNKVCYKN
753 viphi F GSIPCGESCVFIPCISAIIGCSCSSKVCYKN
754 viphi G GSIPCGESCVFIPCISAIIGCSCSNKVCYKN
755 viphi H GIPCAESCVWIPCTVTAIVGCSCSWGVCYN
759 cliotide T8 GIPCGESCVFIPCISSVVGCSCKSKVCYNN
762 cliotide T9 GIPCGESCVFIPCLTTVVGCSCKNKVCYNN
765 cliotide T2 GEFLKCGESCVQGECYTPGCSCDWPICKKN
766 cliotide T12 GIPCGESCVFIPCITGAIGCSCKSKVCYRD
771 Panitide L1 QLPICGETCVLGTCYTPGCRCQYPICVR
772 Panitide L2 QLPICGETCVLGRCYTPNCRCQYPICVR
774 Panitide L4 QAFCGETCLLGTCYTPGCRCTAGICLK
776 Panitide L6 QLPICGETCVLGTCYTPGCSCAYPICVR
778 Panitide L3 QAFCGETCLLGKCYTPGCSCHTGICLK
779 Panitide L5 QLPICGETCVLGTCYTPGCSCAYPICAR
780 Panitide L7 QAFCGETCVLGTCYTPGCSCNFGICLK
781 Panitide L8 QDCGETCVLGTCYTPGCSCSAYPLCV
782 vigno 1 GLPLCGETCAGGTCNTPGCSCSWPVCVRN
783 vigno 2 GSSPLCGETCAGGTCNTPGCSCSWPVCVRD
784 vigno 3 GLPLCGETCVGGTCNTPGCSCSWPVCTRN
785 vigno 4 GLPLCGETCVGGTCNTPACSCSWPVCTRN
786 vigno 5 GLPLCGETCVGGTCNTPGCSCGWPVCVRN
787 vigno 6 GIPCGESCVWIPCISSAIGCSCKGSKVCYRN
788 vigno 7 GTLPCGESCVWIPCISSVVGCSCKNKVCYKN
789 vigno 8 GIPCGESCVWIPCITSAVGCSCKSKVCYRN
790 vigno 9 GIPCGESCVWIPCISSALGCSCKSKVCYRN
791 vigno 10 GTIPCGESCVWIPCISSVVGCSCKSKVCYKD
805 caripe 1 GVIPCGESCVFIPCISTVIGCSCKDKVCYRN
806 caripe 2 GIPCGESCVFIRCTITALLGCSCSNNVCYKN
808 caripe 4 LICSSTCLRIPCLSPRCTCRHHICYLN
810 caripe 6 GAICTGTCFRNPCLSRRCTCRHYICYLN
811 chacur 1 GLPVCGETCVGGTCNTPGCTCSWPICTRN
813 psybra 1 GLPICGETCTLGTCNTPGCTCSWPICTKN
814 paltet 1 GLPICGETCFTGTCNTPGCTCSYPVCTRN
817 psypoe 1 GSVICGETCFTTVCNTPGCYCGAYXCTRN
827 caripe 7 GIPCGESCVFIPCTVTALLGCSCKNKVCYRNGLN
828 caripe 8 GVIPCGESCVFIPCITAAIGCSCKKKVCYRN
859 chassatide C18 GIPCGESCVFIPCISALLGCSCSNKVCYNN
860 chassatide C16 GVPCAESCVYIPCTITALFGCSCKDKVCYNN
861 chassatide C15 GIPCAESCVYIPCTITALLGCSCKDKVCYKN
862 chassatide C13 GFPCAESCVYIPCTVTALLGCSCRNRVCYRN
863 chassatide C17 GIPCGESCVYIPCISAVLGCSCQNKVCYR
864 chassatide C14 GIPCAESCVYIPCTITALFGCSCKDKVCYNN
865 chassatide C8 GAIPCGESCVWIPCISTVIGCSCSNKVCYR
866 chassatide C7 GIPCGESCVWIPCLTAIAGCSCKNKVCYT
867 chassatide C4 GASCGETCFTGICFTAGCSCNPWPTCTRN
868 chassatide C2 GIPCAESCVWIPCTITALMGCSCKNNVCYNN
869 chassatide C1 GDACGETCFTGICFTAGCSCNPWPTCTRN
870 chassatide C3 GIPCGESCWIPCISSALGCSCKNKVCYRN
871 chassatide C5 GVIPCGESCVFIPCISSVVGCSCKNKVCYRN
872 chassatide C6 GVIPCGESCVFIPCISSVIGCSCKNKVCYRN
873 chassatide C9 GIPCGESCVFIPCVTTVIGCSCKDKVCYNN
874 chassatide C10 GEYCGESCYLIPCFTPGCYCVSRQCVNKN
875 chassatide C11 IPCGESCVWIPCISGMFGCSCKDKVCYS
876 chassatide C12 EYCGESCYLIPCFTPGCYCVSRQCVNKN
877 Phyb A GIGCGESCVWIPCVSAAIGCSCSNKICYRN
878 Phyb D GIPCGESCMWIPCISAAIGCSCTNHVCYKN
879 Phyb E GIPCGESCVWIPCISGVQGCSCSNKICYRN
880 Phyb F GIPCGGSCVWIPCISGVQGCSCSNKICYRN
881 Phyb G GIPCGESCAWIPCISAVQGCSCRNKICYRN
882 Phyb H GLPCGESCIWIECISGAIGCSCRNKVCYRN
883 Phyb I GIPCGESCIWIPCTTTALLGCSCSNKVCYKN
884 Phyb J SYTCGESCLWIPCTVTAAFGCYCSNKVCVKD
885 Phyb K STDCGEPCVYIPCTITALLGCSCLNKVCVRP
886 Phyb L QSISCAETCVWIPCATSLIGCSCVNSICTYTN
909 Phyb B GVPCGESCVWMYCISAAMGCSCRNKVCYRN
911 Phyb C GIPCGESCVWMYCITATMGCSCRNKVCYKN
922 vocC GLPVCGETCVGGTCNTPGCSCSWPVCIRN
938 vitri peptide 1 GLIPCGESCVWIPCISSVIGCSCKSKVCYKN
939 vitri peptide 2 GSIPCGESCVWIPCISGIAGCSCSNKVCYLN
940 vitri peptide 3 GSWPCGESCVYIPCITSIAGCECSKNVCYKN
941 vitri peptide 4 GTPCGESCIYVPCISAVFGCWCQSKVCYKD
942 vitri peptide 8 PTPCGETCIWISCVTAAIGCYCHESICYR
943 vitri peptide 9a/53 GTIFDCGETCLLGKCYTPGCSCGSWALCYGQN
944 vitri peptide 14 GSSCGETCEVFSCFITRCACIDGLCYRN
946 vitri peptide 18a GVPICGETCFQGTCNTPGCTCKWPICERN
947 vitri peptide 20 GDLVPCGESCVYIPCLTTVLGCSCSENVCYRN
948 vitri peptide 21 GGPLDCQETCTLSDRCYTKGCTCNWPICYKN
949 vitri peptide 22a GAPVCGETCFTGLCYSSGCSCIYPVCNRN
951 vitri peptide 94b GVAVCGETCTLGTCYTPGCSCDWPICKRN
952 vitri peptide 23 GLPTCGETCTLGTCYTPGCTCSWPLCTKN
953 vitri peptide 24/28 GEPVCGDSCVFFGCDDEGCTCGPWSLCYRN
954 vitri peptide 27a GAFTPCGETCLTGECHTEGCSCVGQTFCVKK
955 vitri peptide 29 GVPSSDCLETCFGGKCNAHRCTCSQWPLCAKN
956 vitri peptide 30 GFACGETCIFTSCFITGCTCNSSLCFRN
957 vitri peptide 36/37 GGTIFSCGESCFQGTCYTKGCACGDWKLCYGEN
958 vitri peptide 38 GDTCYETCFTGFCFIGGCKCDFPVCVKN
959 vitri peptide 39 GAPICGESCFTGTCYTVQCSCSWPVCTRN
960 vitri peptide 39 linear GAPICGESCFTGTCYTVQCSCSWPVCTRN
961 vitri peptide 24a GGTIFNCGESCFQGTCYTKGCACGDWKLCYGEN
962 vitri peptide 50 GDIPCGESCVYIPCITGVLGCSCSHNVCYYN
963 vitri peptide 18b GSVFNCGETCVFGTCFTSGCSCVYRVCSKD
1014 mech 2 GIPTCGETCTLGKCNTPKCTCNWPICYKD
1015 mech 3 GIPTCGETCTLGKCNTPKCTCNWPICYKN
1016 mech 4 GSIPCGESCVYIPCISSIIGCSCKSKVCYKD
1026 mela 7 GIPTCGETCFKGKCYTPGCSCSYPICKKN