Protein List

Found 11 entries.


ID Name Sequence
925 butyrivibriocin AR10 IYFIADKMGIQLAPAWYQDIVNWVSAGGTLTTGFAIIVGV
TVPAWIAEAAAAFGIASA
117 gassericin A IYWIADQFGIHLATGTARKLLDAMASGASLGTAFAAILGV
TLPAWALAAAGALGATAA
220 reutericin 6 IYWIADQFGIHLATGTARKLLDAMASGASLGTAFAAILGV
TLPAWALAAAGALGATAA
222 Uberolysin A LAGYTGIASGTAKKVVDAIDKGAAAFVIISIISTVISAGA
LGAVSASADFIILTVKNYISRNLKAQAVIW
568 Lactocyclicin Q LIDHLGAPRWAVDTILGAIAVGNLASWVLALVPGPGWAVK
AGLATAAAIVKHQGKAAAAAW
566 garvicin ML LVATGMAAGVAKTIVNAVSAGMDIATALSLFSGAFTAAGG
IMALIKKYAQKKLWKQLIAA
927 Carnocyclin A LVAYGIAQGTAEKVVSLINAGLTVGSIISILGGVTVGLSG
VFTAVKAAIAKQGIKKAIQL
929 Leucocyclicin Q LVNQLGISKSLANTILGAIAVGNLASWLLALVPGPGWATK
AALATAETIVKHEGKAAAIAW
84 Ent AS-48 MAKEFGIPAAVAGTVLNVVEAGGWVTTIVSILTAVGSGGL
SLLAAAGRESIKAYLKKEIKKKGKRAVIAW
225 subtilosin A NKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG
119 circularin A VAGALGVQTAAATTIVNVILNAGTLVTVLGIIASIASGGA
GTLMTIGWATFKATVQKLAKQSMARAIAY