Cter 15(998) Protein Card

General Information
Name Cter 15
Sequence GIPCGESCVFIPCTVTALLGCSCKSKVCYKN
Class Cyclotide
Technique NGS
Average Mass 3200.83
Monoisotopic Mass 3198.45
m/z M+H 3200.83
ProteinType Wild type
Parent
Organism Clitoria ternatea L
Notes Highly expressed in C. ternatea root and seed. (Gilding et al. 2016)
Cyclic Yes

Assay
No assays found

References
Gilding,E.K., Jackson,M.A., Poth,A.G., Henriques,S.T., Prentis,P.J., Mahatmanto,T. and Craik,D.J. (2016) Gene coevolution and regulation lock cyclic plant defence peptides to their targets. New Phytol. 210:717-730

Cross-references
Protein precursor(s) Cter 15 precursor
Nucleic acids Cter 15 mRNA
Structure
Links GenBank ALL96746.1
SwissProt A0A0S1RQJ1

Tools