Cter 5(990) Protein Card

General Information
Name Cter 5
Sequence GEFLKCGESCVQGECYTPGCSCDYPICKNN
Class Cyclotide
Technique NGS
Average Mass 3224.59
Monoisotopic Mass 3222.23
m/z M+H 3224.59
ProteinType Wild type
Parent
Organism Clitoria ternatea L
Notes
Cyclic Yes

Assay
No assays found

References
Gilding,E.K., Jackson,M.A., Poth,A.G., Henriques,S.T., Prentis,P.J., Mahatmanto,T. and Craik,D.J. (2016) Gene coevolution and regulation lock cyclic plant defence peptides to their targets. New Phytol. 210:717-730

Cross-references
Protein precursor(s) Cter 5 precursor (partial)
Nucleic acids Cter 5 mRNA partial
Structure
Links GenBank ALL96772.1
SwissProt A0A0S1RSJ8

Tools