Cter 4(989) Protein Card

General Information
Name Cter 4
Alternative name(s) cT39,ctr pep 10
Sequence GDPLACGETCFGGTCYTPGCVCDPWPICTKN
Class Cyclotide
Technique NGS
Average Mass 3185.60
Monoisotopic Mass 3183.24
m/z M+H 3185.6
ProteinType Wild type
Parent
Organism Clitoria ternatea L
Notes Was detected in <i>C. ternatea</i> pod by NGS and MS (Kalmankar et al., 2020)
Cyclic Yes

Assay
No assays found

References
Nguyen KN, Nguyen GK, Nguyen PQ, Ang KH, Dedon PC, Tam JP (2016) Immunostimulating and Gram-negative-specific Antibacterial Cyclotides from the Butterfly Pea Clitoria ternatea. FEBS J doi:10.1111/febs.13720:0-0
Gilding,E.K., Jackson,M.A., Poth,A.G., Henriques,S.T., Prentis,P.J., Mahatmanto,T. and Craik,D.J. (2016) Gene coevolution and regulation lock cyclic plant defence peptides to their targets. New Phytol. 210:717-730
Kalmankar,N.V., Venkatesan,R., Balaram,P. and Sowdhamini,R. (2020) Transcriptomic profiling of the medicinal plant Clitoria ternatea: identification of potential genes in cyclotide biosynthesis. Sci Rep 10:12658-0

Cross-references
Protein precursor(s) Cter 4 precursor (partial)
Cter 4 precursor [partial]
Nucleic acids Cter 4 mRNA (partial)
Structure
Links GenBank ALL96771.1
SwissProt A0A0S1RGB4

Tools