Cter 2(987) Protein Card

General Information
Name Cter 2
Alternative name(s) cT29
Sequence GDPLKCGESCFAGKCYTPGCTCEYPICMNN
Class Cyclotide
Technique NGS,MS
Average Mass 3181.63
Monoisotopic Mass 3179.21
m/z M+H 3181.63
ProteinType Wild type
Parent
Organism Clitoria ternatea L
Notes
Cyclic Yes

Assay
No assays found

References
Nguyen KN, Nguyen GK, Nguyen PQ, Ang KH, Dedon PC, Tam JP (2016) Immunostimulating and Gram-negative-specific Antibacterial Cyclotides from the Butterfly Pea Clitoria ternatea. FEBS J doi:10.1111/febs.13720:0-0
Serra,A., Hemu,X., Nguyen,G.K., Nguyen,N.T., Sze,S.K. and Tam,J.P. (2016) A high-throughput peptidomic strategy to decipher the molecular diversity of cyclic cysteine-rich peptides. Sci Rep 6:23005-0
Gilding,E.K., Jackson,M.A., Poth,A.G., Henriques,S.T., Prentis,P.J., Mahatmanto,T. and Craik,D.J. (2016) Gene coevolution and regulation lock cyclic plant defence peptides to their targets. New Phytol. 210:717-730

Cross-references
Protein precursor(s) Cter 2 precursor (partial)
Nucleic acids Cter 2 mRNA partial
Structure
Links GenBank ALL96749.1
SwissProt A0A0S1RRY1

Tools