cliotide T40(982) Protein Card

General Information
Name cliotide T40
Alternative name(s) cT40,Cter 14,ctr pep 1
Sequence GIPCGESCVFIPCTITALLGCSCKSKVCYKN
Class Cyclotide
Technique MS,NGS
Average Mass 3214.85
Monoisotopic Mass 3212.47
m/z M+H 3214.85
ProteinType Wild type
Parent
Organism Clitoria ternatea L
Notes <p>Was detected in <i>C. ternatea</i> pod and stem by NGS and in <i>C. ternatea</i> stem, leaf and pod by MS (Kalmankar et al., 2020).</p>
Cyclic Yes

Assay
No assays found

References
Nguyen KN, Nguyen GK, Nguyen PQ, Ang KH, Dedon PC, Tam JP (2016) Immunostimulating and Gram-negative-specific Antibacterial Cyclotides from the Butterfly Pea Clitoria ternatea. FEBS J doi:10.1111/febs.13720:0-0
Serra,A., Hemu,X., Nguyen,G.K., Nguyen,N.T., Sze,S.K. and Tam,J.P. (2016) A high-throughput peptidomic strategy to decipher the molecular diversity of cyclic cysteine-rich peptides. Sci Rep 6:23005-0
Gilding,E.K., Jackson,M.A., Poth,A.G., Henriques,S.T., Prentis,P.J., Mahatmanto,T. and Craik,D.J. (2016) Gene coevolution and regulation lock cyclic plant defence peptides to their targets. New Phytol. 210:717-730
Kalmankar,N.V., Venkatesan,R., Balaram,P. and Sowdhamini,R. (2020) Transcriptomic profiling of the medicinal plant Clitoria ternatea: identification of potential genes in cyclotide biosynthesis. Sci Rep 10:12658-0

Cross-references
Protein precursor(s) Cliotide T40 precursor
Cliotide T40 precursor
cliotide T40 precursor
Nucleic acids Cter 14/ cliotide T40 mRNA
Structure
Links GenBank ALL96745
SwissProt A0A0S1RRZ9

Tools