cliotide T40(982) Protein Card

General Information
Name cliotide T40
Alternative name(s) Cter 14,cT40
Sequence GIPCGESCVFIPCTITALLGCSCKSKVCYKN
Class Cyclotide
Technique NGS,MS
Average Mass 3214.85
Monoisotopic Mass 3212.47
m/z M+H 3214.85
ProteinType Wild type
Parent
Organism Clitoria ternatea L
Notes Highly expressed in C. ternatea root. (Gilding et al., 2016)
Cyclic Yes

Assay
No assays found

References
Nguyen KN, Nguyen GK, Nguyen PQ, Ang KH, Dedon PC, Tam JP (2016) Immunostimulating and Gram-negative-specific Antibacterial Cyclotides from the Butterfly Pea Clitoria ternatea. FEBS J doi:10.1111/febs.13720:0-0
Serra,A., Hemu,X., Nguyen,G.K., Nguyen,N.T., Sze,S.K. and Tam,J.P. (2016) A high-throughput peptidomic strategy to decipher the molecular diversity of cyclic cysteine-rich peptides. Sci Rep 6:23005-0
Gilding,E.K., Jackson,M.A., Poth,A.G., Henriques,S.T., Prentis,P.J., Mahatmanto,T. and Craik,D.J. (2016) Gene coevolution and regulation lock cyclic plant defence peptides to their targets. New Phytol. 210:717-730

Cross-references
Protein precursor(s) cliotide T40 precursor
Nucleic acids Cter 14/ cliotide T40 mRNA
Structure
Links GenBank ALL96745
SwissProt A0A0S1RRZ9

Tools