cliotide T11(978) Protein Card

General Information
Name cliotide T11
Alternative name(s) Cter 21
Sequence GIPCGESCVFIPCTITALLGCSCKDKVCYKN
Class Cyclotide
Technique Amino acid analysis,NGS,MS
Average Mass 3242.86
Monoisotopic Mass 3240.46
m/z M+H 3242.86
ProteinType Wild type
Parent
Organism Clitoria ternatea L
Notes Highly expressed in C. ternatea root. (Gilding et al., 2016)
Cyclic Yes

Assay
No assays found

References
Nguyen,G.K., Zhang,S., Nguyen,N.T., Nguyen,P.Q., Chiu,M.S., Hardjojo,A. and Tam,J.P. (2011) Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J. Biol. Chem. 286:24275-24287
Serra,A., Hemu,X., Nguyen,G.K., Nguyen,N.T., Sze,S.K. and Tam,J.P. (2016) A high-throughput peptidomic strategy to decipher the molecular diversity of cyclic cysteine-rich peptides. Sci Rep 6:23005-0
Gilding,E.K., Jackson,M.A., Poth,A.G., Henriques,S.T., Prentis,P.J., Mahatmanto,T. and Craik,D.J. (2016) Gene coevolution and regulation lock cyclic plant defence peptides to their targets. New Phytol. 210:717-730

Cross-references
Protein precursor(s) cliotide T11 precursor (partial)
Nucleic acids Cter 21/ cliotide T11 mRNA partial
Structure
Links GenBank ALL96753.1
SwissProt A0A0S1RQI0

Tools