cliotide T1(975) Protein Card

General Information
Name cliotide T1
Sequence GIPCGESCVFIPCITGAIGCSCKSKVCYRN
Class Cyclotide
Technique Amino acid analysis,NGS,PcR,MS
Average Mass 3085.65
Monoisotopic Mass 3083.36
m/z M+H 3085.65
ProteinType Wild type
Parent
Organism Clitoria ternatea L
Notes High general expression in C. ternatea. (Gilding et al., 2016)
Cyclic Yes

Assay
No assays found

References
Nguyen,G.K., Zhang,S., Nguyen,N.T., Nguyen,P.Q., Chiu,M.S., Hardjojo,A. and Tam,J.P. (2011) Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J. Biol. Chem. 286:24275-24287
Serra,A., Hemu,X., Nguyen,G.K., Nguyen,N.T., Sze,S.K. and Tam,J.P. (2016) A high-throughput peptidomic strategy to decipher the molecular diversity of cyclic cysteine-rich peptides. Sci Rep 6:23005-0
Gilding,E.K., Jackson,M.A., Poth,A.G., Henriques,S.T., Prentis,P.J., Mahatmanto,T. and Craik,D.J. (2016) Gene coevolution and regulation lock cyclic plant defence peptides to their targets. New Phytol. 210:717-730

Cross-references
Protein precursor(s) cliotide T1 precursor
Nucleic acids cliotide T1 mRNA
Structure
Links

Tools