cliotide T17(970) Protein Card

General Information
Name cliotide T17
Alternative name(s) cT17
Sequence GTVPCGESCVFIPCITGIAGCSCKNKVCYLN
Class Cyclotide
Technique NGS,MS
Average Mass 3156.73
Monoisotopic Mass 3154.39
m/z M+H 3156.73
ProteinType Wild type
Parent
Organism Clitoria ternatea L
Notes
Cyclic Yes

Assay
No assays found

References
Nguyen KN, Nguyen GK, Nguyen PQ, Ang KH, Dedon PC, Tam JP (2016) Immunostimulating and Gram-negative-specific Antibacterial Cyclotides from the Butterfly Pea Clitoria ternatea. FEBS J doi:10.1111/febs.13720:0-0
Serra,A., Hemu,X., Nguyen,G.K., Nguyen,N.T., Sze,S.K. and Tam,J.P. (2016) A high-throughput peptidomic strategy to decipher the molecular diversity of cyclic cysteine-rich peptides. Sci Rep 6:23005-0

Cross-references
Nucleic acids cliotide T17 cds
Structure
Links GenBank AML32977.1

Tools