cliotide T14(967) Protein Card

General Information
Name cliotide T14
Sequence DTIPCGESCVWIPCISSILGCSCKDKVCYHN
Class Cyclotide
Technique MS
Average Mass 3350.88
Monoisotopic Mass 3348.42
m/z M+H 3350.88
ProteinType Wild type
Parent
Organism Clitoria ternatea L
Notes
Cyclic Yes

Assay
No assays found

References
Nguyen KN, Nguyen GK, Nguyen PQ, Ang KH, Dedon PC, Tam JP (2016) Immunostimulating and Gram-negative-specific Antibacterial Cyclotides from the Butterfly Pea Clitoria ternatea. FEBS J doi:10.1111/febs.13720:0-0

Cross-references
Nucleic acids
Structure
Links

Tools