cliotide T13(966) Protein Card

General Information
Name cliotide T13
Alternative name(s) Cter23
Sequence DTTPCGESCVWIPCVSSIVGCSCQNKVCYQN
Class Cyclotide
Technique NGS,MS
Average Mass 3300.73
Monoisotopic Mass 3298.33
m/z M+H 3300.73
ProteinType Wild type
Parent
Organism Clitoria ternatea L
Notes Highly expressed in C. ternatea seed & pod. (Gilding et al., 2016)
Cyclic Yes

Assay
No assays found

References
Nguyen KN, Nguyen GK, Nguyen PQ, Ang KH, Dedon PC, Tam JP (2016) Immunostimulating and Gram-negative-specific Antibacterial Cyclotides from the Butterfly Pea Clitoria ternatea. FEBS J doi:10.1111/febs.13720:0-0
Gilding,E.K., Jackson,M.A., Poth,A.G., Henriques,S.T., Prentis,P.J., Mahatmanto,T. and Craik,D.J. (2016) Gene coevolution and regulation lock cyclic plant defence peptides to their targets. New Phytol. 210:717-730

Cross-references
Protein precursor(s) cliotide T13 precursor
Nucleic acids cliotide T13 cds (partial)
Cter 23/ cliotide T13 mRNA (complete)
Structure
Links GenBank ALL96755

Tools