vitri peptide 24a(961) Protein Card

General Information
Name vitri peptide 24a
Sequence GGTIFNCGESCFQGTCYTKGCACGDWKLCYGEN
Class Cyclotide
Technique NGS,MS
Average Mass 3492.86
Monoisotopic Mass 3490.33
m/z M+H 3492.86
ProteinType Wild type
Parent
Organism Viola tricolor
Notes Hellinger et al. identified a possible deamination of Asparagine or Glutamine residues. Also, possible ethylation of glutamic acid residues (Hellinger et al. 2015)
Cyclic Yes

Assay
No assays found

References
Hellinger,R., Koehbach,J., Soltis,D.E., Carpenter,E.J., Wong,G.K. and Gruber,C.W. (2015) Peptidomics of Circular Cysteine-Rich Plant Peptides: Analysis of the Diversity of Cyclotides from Viola tricolor by Transcriptome and Proteome Mining. J. Proteome Res. 14:4851-4862

Cross-references
Nucleic acids
Structure
Links

Tools