vitri peptide 27a(954) Protein Card

General Information
Name vitri peptide 27a
Sequence GAFTPCGETCLTGECHTEGCSCVGQTFCVKK
Class Cyclotide
Technique NGS,MS
Average Mass 3173.59
Monoisotopic Mass 3171.27
m/z M+H 3173.59
ProteinType Wild type
Parent
Organism Viola tricolor
Notes Hellinger et al. identified a possible deamination of Asparagine or Glutamine residues.
Cyclic Yes

Assay
No assays found

References
Hellinger,R., Koehbach,J., Soltis,D.E., Carpenter,E.J., Wong,G.K. and Gruber,C.W. (2015) Peptidomics of Circular Cysteine-Rich Plant Peptides: Analysis of the Diversity of Cyclotides from Viola tricolor by Transcriptome and Proteome Mining. J. Proteome Res. 14:4851-4862

Cross-references
Nucleic acids
Structure
Links

Tools