vitri peptide 17(945) Protein Card

General Information
Name vitri peptide 17
Sequence GSDDQVACGESCAMTPCFMHVVGCVCSQKVCYR
Class Cyclotide
Technique NGS,MS
Average Mass 3491.01
Monoisotopic Mass 3488.37
m/z M+H 3491.01
ProteinType Partial sequence
Parent
Organism Viola tricolor
Notes Possible oxidation of methionine residues (hellinger et al. 2015)
Cyclic Yes

Assay
No assays found

References
Hellinger,R., Koehbach,J., Soltis,D.E., Carpenter,E.J., Wong,G.K. and Gruber,C.W. (2015) Peptidomics of Circular Cysteine-Rich Plant Peptides: Analysis of the Diversity of Cyclotides from Viola tricolor by Transcriptome and Proteome Mining. J. Proteome Res. 14:4851-4862

Cross-references
Nucleic acids
Structure
Links

Tools