Leucocyclicin Q(929) Protein Card

General Information
Name Leucocyclicin Q
Sequence LVNQLGISKSLANTILGAIAVGNLASWLLALVPGPGWATK
AALATAETIVKHEGKAAAIAW
Class Bacterial
Technique PcR,Amino acid analysis
Average Mass 6115.22
Monoisotopic Mass 6111.44
m/z M+H 6112.45
ProteinType Wild type
Parent
Organism Leuconostoc mesenteroides
Notes
Cyclic Yes

Assay
No assays found

References
Masuda,Y., Ono,H., Kitagawa,H., Ito,H., Mu,F., Sawa,N., Zendo,T. and Sonomoto,K. (2011) Identification and characterization of leucocyclicin Q, a novel cyclic bacteriocin produced by Leuconostoc mesenteroides TK41401. Appl. Environ. Microbiol. 77:8164-8170

Cross-references
Protein precursor(s) Leucocyclicin Q precursor
Nucleic acids
Structure
Links

Tools