Leucocyclicin Q precursor(928) Protein Card

General Information
Name Leucocyclicin Q precursor
Sequence MF
LVNQLGISKSLANTILGAIAVGNLASWLLALVPGPGWA
TKAALATAETIVKHEGKAAAIAW
Class Bacterial
Technique PcR
Average Mass 6393.58
Monoisotopic Mass 6389.55
m/z M+H 6390.56
ProteinType Precursor
Parent
Organism Leuconostoc mesenteroides
Notes
Cyclic Yes

Assay
No assays found

References
Masuda,Y., Ono,H., Kitagawa,H., Ito,H., Mu,F., Sawa,N., Zendo,T. and Sonomoto,K. (2011) Identification and characterization of leucocyclicin Q, a novel cyclic bacteriocin produced by Leuconostoc mesenteroides TK41401. Appl. Environ. Microbiol. 77:8164-8170
Mu,F., Masuda,Y., Zendo,T., Ono,H., Kitagawa,H., Ito,H., Nakayama,J. and Sonomoto,K. (2014) Biological function of a DUF95 superfamily protein involved in the biosynthesis of a circular bacteriocin, leucocyclicin Q. J. Biosci. Bioeng. 117:158-164

Cross-references
Domains Leucocyclicin Q (929)
Nucleic acids
Structure
Links SwissProt G5ELQ0

Tools