Leucocyclicin Q precursor(928) Protein Card

General Information
Name Leucocyclicin Q precursor
Sequence MF
LVNQLGISKSLANTILGAIAVGNLASWLLALVPGPGWA
TKAALATAETIVKHEGKAAAIAW
Class Bacterial
Technique PcR
ProteinType Precursor
Parent
Organism Leuconostoc mesenteroides
Notes
Cyclic Yes

Assay
No assays found

References
Masuda,Y., Ono,H., Kitagawa,H., Ito,H., Mu,F., Sawa,N., Zendo,T. and Sonomoto,K. (2011) Identification and characterization of leucocyclicin Q, a novel cyclic bacteriocin produced by Leuconostoc mesenteroides TK41401. Appl. Environ. Microbiol. 77:8164-8170
Mu,F., Masuda,Y., Zendo,T., Ono,H., Kitagawa,H., Ito,H., Nakayama,J. and Sonomoto,K. (2014) Biological function of a DUF95 superfamily protein involved in the biosynthesis of a circular bacteriocin, leucocyclicin Q. J. Biosci. Bioeng. 117:158-164

Cross-references
Domains Leucocyclicin Q (929)
Nucleic acids
Structure
Links SwissProt G5ELQ0

Tools