Tricyclon A precursor (partial)(924) Protein Card

General Information
Name Tricyclon A precursor (partial)
Sequence
AAFALPAAFAS
LETKDVITRAAYEKLVESGAIQGITMTKT
IISN
PILEEALVAHFNHKLG
GGTIFDCGESCFLGTCYTKG
CSCGEWKLCYGTN
SLPESNNEKAMVASLETKDVITRAAYE
KLVNSGAIQGITMTKTIISN
PILEEALVAHFNRKLG
GGTI
FDCGESCFLGTCYTKGCSCGEWKLCYGTN
SLPESNNEKAM
VASLETKDVITRAAYENLVNSGAIQGITMTKTIISN
PILE
EALVSHFNRKLG
GGTIFDCGESCFLGTCYTKGCSCGEWKL
CYGTN
SLA
Class Cyclotide
Average Mass 30719.18
Monoisotopic Mass 30698.94
m/z M+H 30699.95
ProteinType Precursor
Parent
Organism Viola tricolor
Notes
Cyclic Yes

Assay
No assays found

References
Gruber CW, Elliott AG, Ireland DC, Delprete PG, Dessein S, Göransson U, Trabi M, Wang CK, Kinghorn AB, Robbrecht E, Craik DJ (2008) Distribution and evolution of circular miniproteins in flowering plants. Plant Cell 20:2471-2483

Cross-references
Domains tricyclon A (7)
tricyclon A (7)
tricyclon A (7)
Nucleic acids tricyclon A precursor (gene, partial)
Structure
Links SwissProt B6E617

Tools