kalata B1 precursor(920) Protein Card

General Information
Name kalata B1 precursor
Sequence
MAKFTVCLLLCLLLAAFVGAFGS
ELSDSHKTTLVNEIAEK
MLQRKILDGVEATLVTDVAEKMFLRKMKAEA
KTSETADQV
FLKQLQLK
GLPVCGETCVGGTCNTPGCTCSWPVCTRN
GLP
S
Class Cyclotide
Average Mass 13015.36
Monoisotopic Mass 13006.62
m/z M+H 13007.63
ProteinType Precursor
Parent
Organism Oldenlandia affinis
Notes
Cyclic No

Assay
No assays found

References
Gruber CW, Elliott AG, Ireland DC, Delprete PG, Dessein S, Göransson U, Trabi M, Wang CK, Kinghorn AB, Robbrecht E, Craik DJ (2008) Distribution and evolution of circular miniproteins in flowering plants. Plant Cell 20:2471-2483

Cross-references
Domains kalata B1 (1)
Nucleic acids kalata B1 gene [Oak1]
Structure
Links SwissProt B6E618

Tools