[T23K,N25P,G26P,L27G,P28F,V29S,addC_PL]kalata B1(912) Protein Card

General Information
Name [T23K,N25P,G26P,L27G,P28F,V29S,addC_PL]kalata B1
Alternative name(s) ckb-kal
Sequence CGETCVGGTCNTPGCTCSWPVCKRPPGFSPL
Class Cyclotide
Average Mass 3134.60
Monoisotopic Mass 3132.28
m/z M+H 3134.6
ProteinType Grafted
Parent kalata B1
Organism Synthetic
Notes
Cyclic Yes

Assay
No assays found

References
Wong,C.T., Rowlands,D.K., Wong,C.H., Lo,T.W., Nguyen,G.K., Li,H.Y. and Tam,J.P. (2012) Orally active peptidic bradykinin B1 receptor antagonists engineered from a cyclotide scaffold for inflammatory pain treatment. Angew. Chem. Int. Ed. Engl. 51:5620-5624
Poth, A.G., Huang, Y.H., Le, T.T., Kan, M.W. and Craik, D.J., (2019) Pharmacokinetic characterization of kalata B1 and related therapeutics built on the cyclotide scaffold International journal of pharmaceutics 565:437-446

Cross-references
Nucleic acids
Structure
Links

Tools