ckb-kal(912) Protein Card

General Information
Name ckb-kal
Sequence GFSLVCGETCVGGTCNTPGCTCSWPVCKRPP
Class Cyclotide
Average Mass 3136.62
Monoisotopic Mass 3134.3
m/z M+H 3136.62
ProteinType Grafted
Parent kalata B1
Organism Synthetic
Notes
Cyclic Yes

Assay
No assays found

References
Wong,C.T., Rowlands,D.K., Wong,C.H., Lo,T.W., Nguyen,G.K., Li,H.Y. and Tam,J.P. (2012) Orally active peptidic bradykinin B1 receptor antagonists engineered from a cyclotide scaffold for inflammatory pain treatment. Angew. Chem. Int. Ed. Engl. 51:5620-5624

Cross-references
Nucleic acids
Structure
Links

Tools