Phyb B(909) Protein Card

General Information
Name Phyb B
Sequence GVPCGESCVWMYCISAAMGCSCRNKVCYRN
Class Cyclotide
Average Mass 3267.83
Monoisotopic Mass 3265.3
m/z M+H 3267.83
ProteinType Wild type
Parent
Organism Petunia x hybrida
Notes
Cyclic Yes

Assay
No assays found

References
Poth,A.G., Mylne,J.S., Grassl,J., Lyons,R.E., Millar,A.H., Colgrave,M.L. and Craik,D.J. (2012) Cyclotides associate with leaf vasculature and are the products of a novel precursor in petunia (Solanaceae). J. Biol. Chem. 287:27033-27046

Cross-references
Protein precursor(s) Phyb B precursor
Nucleic acids
Structure
Links

Tools