Phyb B precursor(908) Protein Card

General Information
Name Phyb B precursor
Alternative name(s) PETUNITIDE2
Sequence
MAGVNSLRSALYLIILILFVQLTN
FQESRVMAVELSRVFL
PLS
GVPCGESCVWMYCISAAMGCSCRNKVCYRN
EIIQEK
Class Cyclotide
Average Mass 8868.58
Monoisotopic Mass 8862.46
m/z M+H 8863.46
ProteinType Precursor
Parent
Organism Petunia x hybrida
Notes
Cyclic No

Assay
No assays found

References
Poth,A.G., Mylne,J.S., Grassl,J., Lyons,R.E., Millar,A.H., Colgrave,M.L. and Craik,D.J. (2012) Cyclotides associate with leaf vasculature and are the products of a novel precursor in petunia (Solanaceae). J. Biol. Chem. 287:27033-27046

Cross-references
Domains Phyb B (909)
Nucleic acids PETUNITIDE2 mRNA
Structure
Links SwissProt I6QZB1

Tools