Phyb A precursor(907) Protein Card

General Information
Name Phyb A precursor
Alternative name(s) PETUNITIDE1
Sequence
MVRVNSLRSALYLIVLILFVQLTCFSDA
RVMDVDLSRAFL
PLT
GIGCGESCVWIPCVSAAIGCSCSNKICYRN
GIIPEK
Class Cyclotide
Average Mass 8615.31
Monoisotopic Mass 8609.4
m/z M+H 8610.41
ProteinType Precursor
Parent
Organism Petunia x hybrida
Notes
Cyclic No

Assay
No assays found

References
Poth,A.G., Mylne,J.S., Grassl,J., Lyons,R.E., Millar,A.H., Colgrave,M.L. and Craik,D.J. (2012) Cyclotides associate with leaf vasculature and are the products of a novel precursor in petunia (Solanaceae). J. Biol. Chem. 287:27033-27046

Cross-references
Domains Phyb A (877)
Nucleic acids PETUNITIDE1 mRNA
Structure
Links SwissProt I6S3T3

Tools