Phyb J precursor(903) Protein Card

General Information
Name Phyb J precursor
Sequence
MARVNSLKYALCFIVLILFVQLTCIS
ETRVMAVELSRVFL
QTS
SYTCGESCLWIPCTVTAAFGCYCSNKVCVKD
Class Cyclotide
Average Mass 8242.85
Monoisotopic Mass 8237.08
m/z M+H 8238.09
ProteinType Precursor
Parent
Organism Petunia x hybrida
Notes
Cyclic No

Assay
No assays found

References
Poth,A.G., Mylne,J.S., Grassl,J., Lyons,R.E., Millar,A.H., Colgrave,M.L. and Craik,D.J. (2012) Cyclotides associate with leaf vasculature and are the products of a novel precursor in petunia (Solanaceae). J. Biol. Chem. 287:27033-27046

Cross-references
Domains Phyb J (884)
Nucleic acids Phyb J cDNA
Phyb J cDNA 2
Structure
Links

Tools