Phyb H precursor(896) Protein Card

General Information
Name Phyb H precursor
Sequence
MAGVNSLRSALCFIVLILFVQLTCFSDA
RVMDVDLSSVFL
PLS
GLPCGESCIWIECISGAIGCSCRNKVCYRN
EIIPEK
Class Cyclotide
Average Mass 8620.25
Monoisotopic Mass 8614.28
m/z M+H 8615.29
ProteinType Precursor
Parent
Organism Petunia axillaris
Notes
Cyclic No

Assay
No assays found

References
Poth,A.G., Mylne,J.S., Grassl,J., Lyons,R.E., Millar,A.H., Colgrave,M.L. and Craik,D.J. (2012) Cyclotides associate with leaf vasculature and are the products of a novel precursor in petunia (Solanaceae). J. Biol. Chem. 287:27033-27046

Cross-references
Domains Phyb H (882)
Nucleic acids Phyb H mRNA
Structure
Links

Tools