Phyb E precursor (partial)(890) Protein Card

General Information
Name Phyb E precursor (partial)
Sequence HISLLTNSVMAGINSFRPALYFIVLILFVQLTCFSDARVM
DVDLSRVFLPLS
GIPCGESCVWIPCISGVQGCSCSNKICY
RN
GIIPEN
Class Cyclotide
Average Mass 9628.38
Monoisotopic Mass 9621.83
m/z M+H 9622.84
ProteinType Precursor
Parent
Organism Petunia x hybrida
Petunia axillaris
Notes
Cyclic No

Assay
No assays found

References
Poth,A.G., Mylne,J.S., Grassl,J., Lyons,R.E., Millar,A.H., Colgrave,M.L. and Craik,D.J. (2012) Cyclotides associate with leaf vasculature and are the products of a novel precursor in petunia (Solanaceae). J. Biol. Chem. 287:27033-27046

Cross-references
Domains Phyb E (879)
Nucleic acids Phyb E cDNA
Phyb E cDNA
Structure
Links

Tools