Phyb A precursor(887) Protein Card

General Information
Name Phyb A precursor
Sequence
MVGVNSLRSALYLIVLILFVQLTYFSDA
RVMDVDLSRAFL
PLT
GIGCGESCVWIPCVSAAIGCSCSNKICYRN
GIIPKK
Class Cyclotide
Technique EST
Average Mass 8575.27
Monoisotopic Mass 8569.43
m/z M+H 8570.44
ProteinType Precursor
Parent
Organism Petunia x hybrida
Notes
Cyclic No

Assay
No assays found

References
Poth,A.G., Mylne,J.S., Grassl,J., Lyons,R.E., Millar,A.H., Colgrave,M.L. and Craik,D.J. (2012) Cyclotides associate with leaf vasculature and are the products of a novel precursor in petunia (Solanaceae). J. Biol. Chem. 287:27033-27046

Cross-references
Domains Phyb A (877)
Nucleic acids Phyb A mRNA
Structure
Links

Tools