Phyb A(877) Protein Card

General Information
Name Phyb A
Sequence GIGCGESCVWIPCVSAAIGCSCSNKICYRN
Class Cyclotide
Technique EST,MS
Average Mass 3070.56
Monoisotopic Mass 3068.29
m/z M+H 3070.56
ProteinType Wild type
Parent
Organism Petunia x hybrida
Petunia axillaris
Notes
Cyclic Yes

Assay
No assays found

References
Poth,A.G., Mylne,J.S., Grassl,J., Lyons,R.E., Millar,A.H., Colgrave,M.L. and Craik,D.J. (2012) Cyclotides associate with leaf vasculature and are the products of a novel precursor in petunia (Solanaceae). J. Biol. Chem. 287:27033-27046

Cross-references
Protein precursor(s) Phyb A precursor
Phyb A precursor (partial)
Phyb A precursor
Phyb A precursor
Nucleic acids
Structure
Links

Tools