chassatide C6(872) Protein Card

General Information
Name chassatide C6
Alternative name(s) chaC6
Sequence GVIPCGESCVFIPCISSVIGCSCKNKVCYRN
Class Cyclotide
Technique MS,PcR
Average Mass 3255.87
Monoisotopic Mass 3253.47
m/z M+H 3255.87
ProteinType Wild type
Parent
Organism Chassalia chartacea
Notes
Cyclic Yes

Assay
No assays found

References
Nguyen,G.K., Lim,W.H., Nguyen,P.Q. and Tam,J.P. (2012) Novel cyclotides and uncyclotides with highly shortened precursors from Chassalia chartacea and effects of methionine oxidation on bioactivities. J. Biol. Chem. 287:17598-17607

Cross-references
Nucleic acids
Structure
Links

Tools