chassatide C5(871) Protein Card

General Information
Name chassatide C5
Alternative name(s) chaC5
Sequence GVIPCGESCVFIPCISSVVGCSCKNKVCYRN
Class Cyclotide
Technique MS
Average Mass 3241.84
Monoisotopic Mass 3239.45
m/z M+H 3241.84
ProteinType Wild type
Parent
Organism Chassalia chartacea
Notes
Cyclic Yes

Assay
No assays found

References
Nguyen,G.K., Lim,W.H., Nguyen,P.Q. and Tam,J.P. (2012) Novel cyclotides and uncyclotides with highly shortened precursors from Chassalia chartacea and effects of methionine oxidation on bioactivities. J. Biol. Chem. 287:17598-17607

Cross-references
Nucleic acids
Structure
Links

Tools