chassatide C8(865) Protein Card

General Information
Name chassatide C8
Alternative name(s) chaC8
Sequence GAIPCGESCVWIPCISTVIGCSCSNKVCYR
Class Cyclotide
Technique NGS,PcR
Average Mass 3143.70
Monoisotopic Mass 3141.38
m/z M+H 3143.7
ProteinType Wild type
Parent
Organism Chassalia chartacea
Notes
Cyclic No

Assay
No assays found

References
Nguyen,G.K., Lian,Y., Pang,E.W., Nguyen,P.Q., Tran,T.D. and Tam,J.P. (2013) Discovery of linear cyclotides in monocot plant Panicum laxum of Poaceae family provides new insights into evolution and distribution of cyclotides in plants. J. Biol. Chem. 288:3370-3380

Cross-references
Protein precursor(s) chassatide C8 precursor
Nucleic acids
Structure
Links

Tools