chassatide C16(860) Protein Card

General Information
Name chassatide C16
Alternative name(s) chaC16
Sequence GVPCAESCVYIPCTITALFGCSCKDKVCYNN
Class Cyclotide
Technique PcR,Genomic
Average Mass 3278.81
Monoisotopic Mass 3276.39
m/z M+H 3278.81
ProteinType Wild type
Parent
Organism Chassalia chartacea
Notes
Cyclic Yes

Assay
No assays found

References
Nguyen,G.K., Lim,W.H., Nguyen,P.Q. and Tam,J.P. (2012) Novel cyclotides and uncyclotides with highly shortened precursors from Chassalia chartacea and effects of methionine oxidation on bioactivities. J. Biol. Chem. 287:17598-17607

Cross-references
Protein precursor(s) chassatide C16 precursor
Nucleic acids
Structure
Links

Tools