vhl-1(86) Protein Card

General Information
Name vhl-1
Sequence SISCGESCAMISFCFTEVIGCSCKNKVCYLN
Class Cyclotide
Average Mass 3316.88
Monoisotopic Mass 3314.37
m/z M+H 3315.38
ProteinType Wild type
Parent
Organism Viola hederacea
Notes N-SFTI-1-C with Lys5 substituted with N-(4-aminobutyl)-glycine residue.
Cyclic Yes

Assay
Anti-HIV
vhl-1 inhibited HIV infection with EC50 of 0.87 uM [...]Chen B et al. (2005) J Biol Chem 280:22395-405
Anti-bacterial
vhl-1 displays no anti-bacterial activity [...]Chen B et al. (2005) J Biol Chem 280:22395-405
NOE Restraint
NOE restraints for 1ZA8 [...]
Chemical Shift
Chemical shift data for vhl-1 [...]
Nematocidal
A range of natural variants were selected based on net charge and/or hydrophobicity and were tested alongside the prototypic cyclotide kB1 in larval development assays with H. contortus and T. colubriformis. [...]Colgrave ML et al. (2008) Chembiochem 9:1939-1945

References
Chen B, Colgrave ML, Daly NL, Rosengren KJ, Gustafson KR, Craik DJ (2005) Isolation and characterisation of novel cyclotides from viola hederaceae: Solution structure and anti-HIV activity of VHL-1, a leaf-specific-expressed cyclotide. J Biol Chem 280:22395-405

Cross-references
Nucleic acids
Structure NMR solution structure of a leaf-specific-expressed cyclotide vhl-1
Links GenBank P84522.1
SwissProt P84522

Tools