chassatide C18(859) Protein Card

General Information
Name chassatide C18
Alternative name(s) chaC18
Sequence GIPCGESCVFIPCISALLGCSCSNKVCYNN
Class Cyclotide
Technique PcR,Genomic
Average Mass 3071.58
Monoisotopic Mass 3069.3
m/z M+H 3071.58
ProteinType Wild type
Parent
Organism Chassalia chartacea
Notes
Cyclic Yes

Assay
No assays found

References
Nguyen,G.K., Lim,W.H., Nguyen,P.Q. and Tam,J.P. (2012) Novel cyclotides and uncyclotides with highly shortened precursors from Chassalia chartacea and effects of methionine oxidation on bioactivities. J. Biol. Chem. 287:17598-17607

Cross-references
Protein precursor(s) chassatide C18 precursor
Nucleic acids
Structure
Links

Tools