chassatide C8 precursor(855) Protein Card

General Information
Name chassatide C8 precursor
Sequence
MAKFANYLMLFLLVASLVMLEA
QSSDTIKAPDWGKRLLMN
HDSDL
GAIPCGESCVWIPCISTVIGCSCSNKVCYR
Class Cyclotide
Average Mass 8230.76
Monoisotopic Mass 8225.02
m/z M+H 8226.03
ProteinType Precursor
Parent
Organism Chassalia chartacea
Notes
Cyclic No

Assay
No assays found

References
Nguyen,G.K., Lian,Y., Pang,E.W., Nguyen,P.Q., Tran,T.D. and Tam,J.P. (2013) Discovery of linear cyclotides in monocot plant Panicum laxum of Poaceae family provides new insights into evolution and distribution of cyclotides in plants. J. Biol. Chem. 288:3370-3380

Cross-references
Domains chassatide C8 (865)
Nucleic acids chassatide C8 mRNA, complete cds
Structure
Links

Tools