chassatide C14 precursor(854) Protein Card

General Information
Name chassatide C14 precursor
Sequence
MAKFATQLLLFVLIASLVMLEVHA
SNTFQVPDLGKRLLMN
RDPN
GIPCAESCVYIPCTITALFGCSCKDKVCYNN
EL
Class Cyclotide
Average Mass 8498.11
Monoisotopic Mass 8492.27
m/z M+H 8493.27
ProteinType Precursor
Parent
Organism Chassalia chartacea
Notes
Cyclic No

Assay
No assays found

References
Nguyen,G.K., Lim,W.H., Nguyen,P.Q. and Tam,J.P. (2012) Novel cyclotides and uncyclotides with highly shortened precursors from Chassalia chartacea and effects of methionine oxidation on bioactivities. J. Biol. Chem. 287:17598-17607

Cross-references
Domains chassatide C14 (864)
Nucleic acids chassatide C14 mRNA, complete cds
Structure
Links

Tools