chassatide C16 precursor(850) Protein Card

General Information
Name chassatide C16 precursor
Sequence
MAKFATQLLLFVLIASLVMLEVHA
VNTFQVPDLGKRLLMN
RDPN
GVPCAESCVYIPCTITALFGCSCKDKVCYNN
EL
Class Cyclotide
Average Mass 8496.14
Monoisotopic Mass 8490.29
m/z M+H 8491.3
ProteinType Precursor
Parent
Organism Chassalia chartacea
Notes
Cyclic No

Assay
No assays found

References
Nguyen,G.K., Lim,W.H., Nguyen,P.Q. and Tam,J.P. (2012) Novel cyclotides and uncyclotides with highly shortened precursors from Chassalia chartacea and effects of methionine oxidation on bioactivities. J. Biol. Chem. 287:17598-17607

Cross-references
Domains chassatide C16 (860)
Nucleic acids chassatide C16 gene
chassatide C16 mRNA, complete cds
Structure
Links

Tools