chassatide C18 precursor(849) Protein Card

General Information
Name chassatide C18 precursor
Sequence
MAKFANYLTLFLLVASLVMMEVHSSSS
TEVPDQGRRLLMN
PDSN
GIPCGESCVFIPCISALLGCSCSNKVCYNN
RTKS
Class Cyclotide
Average Mass 8464.88
Monoisotopic Mass 8459.07
m/z M+H 8460.08
ProteinType Precursor
Parent
Organism Chassalia chartacea
Notes
Cyclic No

Assay
No assays found

References
Nguyen,G.K., Lim,W.H., Nguyen,P.Q. and Tam,J.P. (2012) Novel cyclotides and uncyclotides with highly shortened precursors from Chassalia chartacea and effects of methionine oxidation on bioactivities. J. Biol. Chem. 287:17598-17607

Cross-references
Domains chassatide C18 (859)
Nucleic acids chassatide C18 gene, complete cds
chassatide C18 mRNA, complete cds
Structure
Links

Tools