MCo-CVX-5c(842) Protein Card

General Information
Name MCo-CVX-5c
Sequence VCPKILQRCRRDSDCPGACICRGNGYCGSYRXCRGpRRBC
YXK
Class Squash trypsin inhibitor
Average Mass 4448.17
Monoisotopic Mass 4444.99
m/z M+H 4448.17
ProteinType Grafted
Parent MCoTI-I
Organism Synthetic
Notes B, X and p represent the amino acid, 2-naphthylalanine, citruline and D-proline, respectively.
Cyclic Yes

Assay
No assays found

References
Aboye,T.L., Ha,H., Majumder,S., Christ,F., Debyser,Z., Shekhtman,A., Neamati,N. and Camarero,J.A. (2012) Design of a novel cyclotide-based CXCR4 antagonist with anti-human immunodeficiency virus (HIV)-1 activity. J. Med. Chem. 55:10729-10734

Cross-references
Nucleic acids
Structure
Links

Tools