caripe 8 precursor(834) Protein Card

General Information
Name caripe 8 precursor
Sequence
MAKFANFLMLFLLVASLVMLEVHSSNS
NQVPDLGRRLLMN
PDAN
GVIPCGESCVFIPCITAAIGCSCKKKVCYRN
GLDSE
NI
Class Cyclotide
Average Mass 8875.53
Monoisotopic Mass 8869.42
m/z M+H 8870.42
ProteinType Precursor
Parent
Organism Carapichea ipecacuanha
Notes Retrieved from the 1KP project. Credit should be given to the 1KP project if using this sequence http://www.onekp.com/.
Cyclic Yes

Assay
No assays found

References

Cross-references
Domains caripe 8 (828)
Nucleic acids caripe 8 cDNA [plantlet]
Structure
Links

Tools