mram 10 precursor (partial)(832) Protein Card

General Information
Name mram 10 precursor (partial)
Sequence
MNPDSN
GVIPCGESCVFIPCISSVLGCSCKNKVCYRN
G
Class Cyclotide
Average Mass 3995.67
Monoisotopic Mass 3992.79
m/z M+H 3993.8
ProteinType Precursor
Parent
Organism Carapichea ipecacuanha
Notes Retrieved from the 1KP project. Credit should be given to the 1KP project if using this sequence http://www.onekp.com/.
Cyclic No

Assay
No assays found

References

Cross-references
Domains Mra23 (407)
Nucleic acids
Structure
Links

Tools