caripe 8(828) Protein Card

General Information
Name caripe 8
Sequence GVIPCGESCVFIPCITAAIGCSCKKKVCYRN
Class Cyclotide
Technique MS,Amino acid analysis
Average Mass 3239.91
Monoisotopic Mass 3237.51
m/z M+H 3239.91
ProteinType Wild type
Parent
Organism Carapichea ipecacuanha
Notes Retrieved from the 1KP project. Credit should be given to the 1KP project if using this sequence http://www.onekp.com/. Sequence confirmed by MS + amino acid analysis. Inhibits CRF1R-mediated cAMP responses (Fahradpour et al).
Cyclic Yes

Assay
No assays found

References

Cross-references
Protein precursor(s) caripe 8 precursor
caripe 8 precursor
Nucleic acids
Structure
Links

Tools