caripe 7(827) Protein Card

General Information
Name caripe 7
Sequence GIPCGESCVFIPCTVTALLGCSCKNKVCYRN
Class Cyclotide
Technique MS,Amino acid analysis
Average Mass 3255.87
Monoisotopic Mass 3253.47
m/z M+H 3255.87
ProteinType Wild type
Parent
Organism Carapichea ipecacuanha
Notes Transcriptome sequence initially retrieved from the 1KP project. Credit should be given to the 1KP project if using this sequence http://www.onekp.com/. Sequence confirmed by MS + amino acid analysis. (Fahradpour et al)
Cyclic Yes

Assay
No assays found

References

Cross-references
Protein precursor(s) caripe 7 precursor
Nucleic acids
Structure
Links

Tools