caripe 7(827) Protein Card

General Information
Name caripe 7
Sequence GIPCGESCVFIPCTVTALLGCSCKNKVCYRNGLN
Class Cyclotide
Average Mass 3540.18
Monoisotopic Mass 3537.62
m/z M+H 3540.18
ProteinType Wild type
Parent
Organism Carapichea ipecacuanha
Notes Retrieved from the 1KP project. Credit should be given to the 1KP project if using this sequence http://www.onekp.com/.
Cyclic Yes

Assay
No assays found

References

Cross-references
Protein precursor(s) caripe 7 precursor
Nucleic acids
Structure
Links

Tools