caripe3 precursor [partial](824) Protein Card

General Information
Name caripe3 precursor [partial]
Sequence
MAKFANYLMLFLLIASLAMLEVHS
SNNIQVPXGRRLLTNP
EPN
GIPCGESCVFIPCISAVVGCSCSNKVCYNN
GLSS
Class Cyclotide
Average Mass 8122.56
Monoisotopic Mass 8116.99
m/z M+H 8118
ProteinType Precursor
Parent
Organism Carapichea ipecacuanha
Notes Retrieved from the 1KP project. The accession numbers of contig sequences are different from the ones provided by Koehbach et al. Minor credit should be given to the 1KP project if using this sequence http://www.onekp.com/.
Cyclic No

Assay
No assays found

References
Koehbach,J., Attah,A.F., Berger,A., Hellinger,R., Kutchan,T.M., Carpenter,E.J., Rolf,M., Sonibare,M.A., Moody,J.O., Wong,G.K., Dessein,S., Greger,H. and Gruber,C.W. (2013) Cyclotide discovery in Gentianales revisited-identification and characterization of cyclic cystine-knot peptides and their phylogenetic distribution in Rubiaceae plants. Biopolymers 100:438-452

Cross-references
Domains caripe 3 (807)
Nucleic acids caripe 3 cDNA [plantlet]
caripe 3 cDNA [root]
Structure
Links

Tools