caripe 3(807) Protein Card

General Information
Name caripe 3
Sequence GIPCGESCVFIPCISAVVGCSCSNKVCYNN
Class Cyclotide
Technique NGS
Average Mass 3043.53
Monoisotopic Mass 3041.27
m/z M+H 3043.53
ProteinType Partial sequence
Parent
Organism Carapichea ipecacuanha
Notes The sequence presented on this card differs from the one published by Koehbach et al. by three positions:the first residue was noted undetermined by Koehbach but was found in the 1KP nucelic sequence, the serine at position 23 in Koehlbach was removed and a serine at position 23 was added (ie GCSCSNK instead of GSCSCNK). Koehbach et al. state that they extracted this sequence from the 1KP project from the BQEQ sequencing, but a blast alignment retrieve only the sequence displayed here, suggesting that the sequence in Koehbach et al. is erroneous.
Cyclic Yes

Assay
No assays found

References
Koehbach,J., Attah,A.F., Berger,A., Hellinger,R., Kutchan,T.M., Carpenter,E.J., Rolf,M., Sonibare,M.A., Moody,J.O., Wong,G.K., Dessein,S., Greger,H. and Gruber,C.W. (2013) Cyclotide discovery in Gentianales revisited-identification and characterization of cyclic cystine-knot peptides and their phylogenetic distribution in Rubiaceae plants. Biopolymers 100:438-452

Cross-references
Protein precursor(s) caripe3 precursor [partial]
Nucleic acids
Structure
Links

Tools