TIPTOP3(800) Protein Card

General Information
Name TIPTOP3
Sequence
MESKKILPVVLVAMMLVATSTG
FNDGDTIDLISDGRAQID
IN
GGVCPKILQRCRRDSDCPGACICLGNGYCGSGSD
ALEG
LVSDGRAQIDIN
GGVCPKILKKCRRDSDCPGACICRGNGY
CGSGSD
ALEGLMSDGQAQIDIN
GGVCPKILKKCRRDSDCP
GACICRGNGYCGSGSD
ALEGLMSDGRAQIDIN
GGVCPKIL
KKCRRDSDCPGACICRGNGYCGSGSD
ALEGLMSDGRAQID
IN
GGVCPKILKKCRRDSDCPGACICRGNGYCGSGSD
ALEG
LMSDGRAQIDIN
GGVCPKILKKCRRDSDCPGACICRGNGY
CGSGSD
ALEGLMSDGRAQIDIN
GGACPRILKKCRRDSDCP
GACVCKGNGYCGSGSD
AIDLISDAGAQTGEDINGGGVYDE
K
QRACPRILKKCRRDSDCPGECICQGNGYCG
Class Squash trypsin inhibitor
Average Mass 44483.61
Monoisotopic Mass 44453.56
m/z M+H 44454.57
ProteinType Precursor
Parent
Organism Momordica cochinchinensis
Notes
Cyclic Yes

Assay
No assays found

References
Mylne,J.S., Chan,L.Y., Chanson,A.H., Daly,N.L., Schaefer,H., Bailey,T.L., Nguyencong,P., Cascales,L. and Craik,D.J. (2012) Cyclic peptides arising by evolutionary parallelism via asparaginyl-endopeptidase-mediated biosynthesis. Plant Cell 24:2765-2778

Cross-references
Domains MCoTI-VI (795)
MCoTI-VII (797)
MCoTI-II (3)
MCoTI-II (3)
MCoTI-II (3)
MCoTI-II (3)
MCoTI-II (3)
MCoTI-VIII (798)
Nucleic acids Momordica cochinchinensis two inhibitor peptide topologies precursor 3 (TIPTOP3) mRNA, complete cds
Structure
Links SwissProt J3R9Z5

Tools