cyclotide c2 precursor(80) Protein Card

General Information
Name cyclotide c2 precursor
Sequence
MEMKNMVVGLFLIAAFALPALAT
SFEKDFITHETVQAILK
KVGPSSNGMLDEQAISALTGKTIISN
PVLEEALLTHSNSI
NALG
GTLPCGESCVWIPCISAVVGCSCKSKVCYKN
SLA
Class Cyclotide
Average Mass 12397.53
Monoisotopic Mass 12389.27
m/z M+H 12390.28
ProteinType Precursor
Parent
Organism Viola odorata
Notes Precursor protein
Cyclic No

Assay
No assays found

References
Dutton JL, Renda RF, Waine C, Clark RJ, Daly NL, Jennings CV, Anderson MA, Craik DJ (2004) Conserved structural and sequence elements implicated in the processing of gene-encoded circular proteins. J Biol Chem 279:46858-67

Cross-references
Domains cycloviolacin O11 (28)
Nucleic acids cyclotide c2 precursor
Structure
Links GenBank AAU04392.1
SwissProt Q5USP0

Tools