TIPTOP2(799) Protein Card

General Information
Name TIPTOP2
Sequence
MESKKILPVVLVAMMLVATSTG
FNDGDTIELISDGRAQID
IN
GGVCPKILQRCRRDSDCPGACICRGNGYCGSGSD
ALEG
LMSDGRAQIDIN
GGVCPKILKKCRRDSDCPGACICRGNGY
CGSGSD
ALEGLMSDSRAQIDIN
GGVCPKILKKCRRDSDCP
GACICRGNGYCGSGSD
ALEGLMSDGRAQIDIN
GGVCPKIL
KKCRRDSDCPGACICRGNGYCGSGSD
AIDGLISDGRAQID
IN
GGACPRILKKCRRDSDCPGACVCQGNGYCGSGSD
AIDL
IYDAGAQTGEDINGGGVYDEK
QRACPRILKKCRRDSDCPG
ECICKGNGYCG
Class Squash trypsin inhibitor
Average Mass 34405.13
Monoisotopic Mass 34381.97
m/z M+H 34382.97
ProteinType Precursor
Parent
Organism Momordica cochinchinensis
Notes
Cyclic No

Assay
No assays found

References
Mylne,J.S., Chan,L.Y., Chanson,A.H., Daly,N.L., Schaefer,H., Bailey,T.L., Nguyencong,P., Cascales,L. and Craik,D.J. (2012) Cyclic peptides arising by evolutionary parallelism via asparaginyl-endopeptidase-mediated biosynthesis. Plant Cell 24:2765-2778

Cross-references
Domains MCoTI-V (793)
MCoTI-IV (796)
MCoTI-II (3)
MCoTI-II (3)
MCoTI-II (3)
MCoTI-I (137)
Nucleic acids Momordica cochinchinensis two inhibitor peptide topologies precursor 2 (TIPTOP2) mRNA, complete cds
Structure
Links SwissProt J3R2I9

Tools