MCoTI-IV(796) Protein Card

General Information
Name MCoTI-IV
Alternative name(s) TI-4
Sequence GGACPRILKKCRRDSDCPGACVCQGNGYCGSGSD
Class Squash trypsin inhibitor
Average Mass 3410.81
Monoisotopic Mass 3408.41
m/z M+H 3409.42
ProteinType Wild type
Parent
Organism Momordica cochinchinensis
Notes
Cyclic Yes

Assay
No assays found

References
Mylne,J.S., Chan,L.Y., Chanson,A.H., Daly,N.L., Schaefer,H., Bailey,T.L., Nguyencong,P., Cascales,L. and Craik,D.J. (2012) Cyclic peptides arising by evolutionary parallelism via asparaginyl-endopeptidase-mediated biosynthesis. Plant Cell 24:2765-2778

Cross-references
Protein precursor(s) TIPTOP2
Nucleic acids
Structure
Links

Tools