TIPTOP1(792) Protein Card

General Information
Name TIPTOP1
Sequence
MESKKILPVVLVAMMLVATSTG
FNDGDTIELISDGRAQID
IN
GGVCPKILQRCRRDSDCPGACICRGNGYCGSGSD
ALEG
LMSDGRAQIDIN
GGVCPKILKKCRRDSDCPGACICRGNGY
CGSGSD
ALEGLMSDGRAQIDIN
GGVCPKILKKCRRDSDCP
GACICRGNGYCGSGSD
ALEGLMSDSRAQIDIN
GGVCPKIL
KKCRRDSDCPGACICRGNGYCGSGSD
AIDLIYDAGAQTGE
DINGGGVYDEK
QRACPRILKKCRRDSDCPGECICKGNGYC
G
Class Squash trypsin inhibitor
Average Mass 29335.45
Monoisotopic Mass 29315.66
m/z M+H 29316.66
ProteinType Precursor
Parent
Organism Momordica cochinchinensis
Notes
Cyclic No

Assay
No assays found

References
Mylne,J.S., Chan,L.Y., Chanson,A.H., Daly,N.L., Schaefer,H., Bailey,T.L., Nguyencong,P., Cascales,L. and Craik,D.J. (2012) Cyclic peptides arising by evolutionary parallelism via asparaginyl-endopeptidase-mediated biosynthesis. Plant Cell 24:2765-2778

Cross-references
Domains MCoTI-V (793)
MCoTI-II (3)
MCoTI-II (3)
MCoTI-II (3)
MCoTI-I (137)
Nucleic acids Momordica cochinchinensis two inhibitor peptide topologies precursor 1 (TIPTOP1) mRNA, complete cds
Structure
Links SwissProt J3RCD6

Tools